PDB entry 1wwp

View 1wwp on RCSB PDB site
Description: Crystal structure of ttk003001694 from Thermus Thermophilus HB8
Deposited on 2005-01-12, released 2005-07-12
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.11 Å
R-factor: 0.217
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA0636
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKK7 (0-118)
      • modified residue (0)
      • modified residue (79)
      • modified residue (109)
  • Chain 'B':
    Compound: hypothetical protein TTHA0636
    Species: Thermus thermophilus [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKK7 (0-118)
      • modified residue (0)
      • modified residue (79)
      • modified residue (109)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wwpA (A:)
    maekalatlkelafledpspverdaaiqrfeytfeafwkalqaylrekeglegaspkgvi
    rlarevgllrdeearlalgmvddrsltvhtyneplaraifrrlpdyarlmeqvlgrlrr
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wwpB (B:)
    maekalatlkelafledpspverdaaiqrfeytfeafwkalqaylrekeglegaspkgvi
    rlarevgllrdeearlalgmvddrsltvhtyneplaraifrrlpdyarlmeqvlgrlrr