PDB entry 1wwl

View 1wwl on RCSB PDB site
Description: crystal structure of cd14
Deposited on 2005-01-06, released 2005-02-22
The last revision was dated 2020-07-29, with a file datestamp of 2020-07-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.215
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Monocyte differentiation antigen CD14
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
  • Chain 'B':
    Compound: Monocyte differentiation antigen CD14
    Species: Mus musculus [TaxId:10090]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P10810 (2-311)
      • cloning artifact (0-1)
  • Heterogens: NAG, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wwlA (A:)
    adpepceldeescscnfsdpkpdwssafnclgaadvelygggrsleyllkrvdteadlgq
    ftdiikslslkrltvraaripsrilfgalrvlgisglqeltlenlevtgtappplleatg
    pdlnilnlrnvswatrdawlaelqqwlkpglkvlsiaqahslnfsceqvrvfpalstldl
    sdnpelgerglisalcplkfptlqvlalrnagmetpsgvcsalaaarvqlqgldlshnsl
    rdaagapscdwpsqlnslnlsftglkqvpkglpaklsvldlsynrldrnpspdelpqvgn
    lslkgnpfldse
    

    Sequence, based on observed residues (ATOM records):
    >1wwlA (A:)
    pceldeescscnfsdpkpdwssafnclgaadvelygggrsleyllkrvdteadlgqftdi
    ikslslkrltvraaripsrilfgalrvlgisglqeltlenlevtgtappplleatgpdln
    ilnlrnvswatrdawlaelqqwlkpglkvlsiaqahslnfsceqvrvfpalstldlsdnp
    elgerglisalcplkfptlqvlalrnagmetpsgvcsalaaarvqlqgldlshnslrdaa
    gapscdwpsqlnslnlsftglkqvpkglpaklsvldlsynrldrnpspdelpqvgnlslk
    gnpfldse
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records:
    >1wwlB (B:)
    adpepceldeescscnfsdpkpdwssafnclgaadvelygggrsleyllkrvdteadlgq
    ftdiikslslkrltvraaripsrilfgalrvlgisglqeltlenlevtgtappplleatg
    pdlnilnlrnvswatrdawlaelqqwlkpglkvlsiaqahslnfsceqvrvfpalstldl
    sdnpelgerglisalcplkfptlqvlalrnagmetpsgvcsalaaarvqlqgldlshnsl
    rdaagapscdwpsqlnslnlsftglkqvpkglpaklsvldlsynrldrnpspdelpqvgn
    lslkgnpfldse