PDB entry 1wwk

View 1wwk on RCSB PDB site
Description: Crystal structure of phosphoglycerate dehydrogenase from Pyrococcus horikoshii OT3
Deposited on 2005-01-06, released 2006-01-17
The last revision was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.224
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphoglycerate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB NP_143266 (Start-306)
  • Chain 'B':
    Compound: phosphoglycerate dehydrogenase
    Species: Pyrococcus horikoshii [TaxId:70601]
    Database cross-references and differences (RAF-indexed):
    • GB NP_143266
  • Heterogens: NAD, HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.08, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wwkA (A:)
    mkrmkvlvaaplhekaiqvlkdagleviyeeypdedrlvelvkdveaiivrskpkvtrrv
    iesapklkviaragvgldnidveaakekgievvnapaassrsvaelavglmfsvarkiaf
    adrkmregvwakkeamgielegktigiigfgrigyqvakianalgmnillydpypneera
    kevngkfvdletllkesdvvtihvplvestyhlineerlklmkktailintsrgpvvdtn
    alvkalkegwiagagldvfeeeplpkdhpltkfdnvvltphigastveaqeragvevaek
    vvkilkg
    

    Sequence, based on observed residues (ATOM records):
    >1wwkA (A:)
    mkvlvaaplhekaiqvlkdagleviyeeypdedrlvelvkdveaiivrskpkvtrrvies
    apklkviaragvgldnidveaakekgievvnapaassrsvaelavglmfsvarkiafadr
    kmregvwakkeamgielegktigiigfgrigyqvakianalgmnillydpypneerakev
    ngkfvdletllkesdvvtihvplvestyhlineerlklmkktailintsrgpvvdtnalv
    kalkegwiagagldvfeeeplpkdhpltkfdnvvltphigastveaqeragvevaekvvk
    ilkg
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wwkB (B:)
    mkrmkvlvaaplhekaiqvlkdagleviyeeypdedrlvelvkdveaiivrskpkvtrrv
    iesapklkviaragvgldnidveaakekgievvnapaassrsvaelavglmfsvarkiaf
    adrkmregvwakkeamgielegktigiigfgrigyqvakianalgmnillydpypneera
    kevngkfvdletllkesdvvtihvplvestyhlineerlklmkktailintsrgpvvdtn
    alvkalkegwiagagldvfeeeplpkdhpltkfdnvvltphigastveaqeragvevaek
    vvkilkg
    

    Sequence, based on observed residues (ATOM records):
    >1wwkB (B:)
    mkvlvaaplhekaiqvlkdagleviyeeypdedrlvelvkdveaiivrskpkvtrrvies
    apklkviaragvgldnidveaakekgievvnapaassrsvaelavglmfsvarkiafadr
    kmregvwakkeamgielegktigiigfgrigyqvakianalgmnillydpypneerakev
    ngkfvdletllkesdvvtihvplvestyhlineerlklmkktailintsrgpvvdtnalv
    kalkegwiagagldvfeeeplpkdhpltkfdnvvltphigastveaqeragvevaekvvk
    il