PDB entry 1wwi

View 1wwi on RCSB PDB site
Description: Crystal structure of ttk003001566 from Thermus Thermophilus HB8
Class: structural genomics, unknown function
Keywords: STRUCTURAL GENOMICS, UNKNOWN FUNCTION, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-01-05, released 2005-07-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.58 Å
R-factor: 0.186
AEROSPACI score: 0.61 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein TTHA1479
    Species: Thermus thermophilus HB8 [TaxId:300852]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SI95 (0-147)
      • modified residue (0)
      • modified residue (2)
      • modified residue (75)
    Domains in SCOPe 2.07: d1wwia1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwiA (A:)
    mlmkvaeferlfrqaagldvdkndlkrvsdflrnklydllavaernakyngrdlifepdl
    piakglqetlqefrrmdtalelkpvldalaalppldlevaedvrnllpelagalvvayar
    vlkeldpalknpqtehheraervfnlll