PDB entry 1wwh

View 1wwh on RCSB PDB site
Description: Crystal structure of the MPPN domain of mouse Nup35
Class: protein transport
Keywords: Structural Genomics, MPPN, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2005-01-05, released 2005-07-05
The last revision prior to the SCOP 1.73 freeze date was dated 2007-04-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: 0.211
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoporin 35
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wwha1
  • Chain 'B':
    Compound: nucleoporin 35
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wwhb1
  • Chain 'C':
    Compound: nucleoporin 35
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wwhc1
  • Chain 'D':
    Compound: nucleoporin 35
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wwhd1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wwhA (A:)
    gssgssgpfytqgdsltsedhlddtwvtvfgfpqasasyillqfaqygnilkhvmsntgn
    wmhiryqsklqarkalskdgrifgesimigvkpcidknvmensdrgvlsspslsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwhA (A:)
    hlddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdg
    rifgesimigvkpcidknvme
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wwhB (B:)
    gssgssgpfytqgdsltsedhlddtwvtvfgfpqasasyillqfaqygnilkhvmsntgn
    wmhiryqsklqarkalskdgrifgesimigvkpcidknvmensdrgvlsspslsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwhB (B:)
    ddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgri
    fgesimigvkpcidknvme
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wwhC (C:)
    gssgssgpfytqgdsltsedhlddtwvtvfgfpqasasyillqfaqygnilkhvmsntgn
    wmhiryqsklqarkalskdgrifgesimigvkpcidknvmensdrgvlsspslsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwhC (C:)
    ddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgri
    fgesimigvkpcidknvme
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wwhD (D:)
    gssgssgpfytqgdsltsedhlddtwvtvfgfpqasasyillqfaqygnilkhvmsntgn
    wmhiryqsklqarkalskdgrifgesimigvkpcidknvmensdrgvlsspslsgpssg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwhD (D:)
    lddtwvtvfgfpqasasyillqfaqygnilkhvmsntgnwmhiryqsklqarkalskdgr
    ifgesimigvkpcidknvme