PDB entry 1wwg

View 1wwg on RCSB PDB site
Description: NMR Structure Determined for MLV NC Complex with RNA Sequence UAUCUG
Class: Viral protein/RNA
Keywords: Hydrophobic Guanosine Binding pocket, Viral protein/RNA COMPLEX
Deposited on 2005-01-05, released 2005-04-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoprotein p10
    Species: Murine leukemia virus [TaxId:11801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wwga_
  • Chain 'B':
    Compound: 5'-r(p*up*ap*up*cp*up*g)-3'
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wwgA (A:)
atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll

  • Chain 'B':
    No sequence available.