PDB entry 1wwf

View 1wwf on RCSB PDB site
Description: NMR Structure Determined for MLV NC Complex with RNA Sequence CCUCCGU
Class: Viral protein/RNA
Keywords: Hydrophobic Guanosine Binding pocket, Viral protein-RNA COMPLEX
Deposited on 2005-01-05, released 2005-04-05
The last revision prior to the SCOPe 2.02 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoprotein p10
    Species: Murine leukemia virus [TaxId:11801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.02: d1wwfa1
  • Chain 'B':
    Compound: 5'-r(p*cp*cp*up*cp*cp*gp*u)-3'
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wwfA (A:)
    atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll
    

  • Chain 'B':
    No sequence available.