PDB entry 1wwf

View 1wwf on RCSB PDB site
Description: NMR Structure Determined for MLV NC Complex with RNA Sequence CCUCCGU
Class: Viral protein/RNA
Keywords: Hydrophobic Guanosine Binding pocket, Viral protein-RNA COMPLEX
Deposited on 2005-01-05, released 2005-04-05
The last revision prior to the SCOPe 2.01 freeze date was dated 2011-12-14, with a file datestamp of 2011-12-09.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Nucleoprotein p10
  Species: Murine leukemia virus [TaxId:11801]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P03332 (0-55)
  Domains in SCOPe 2.01: d1wwfa1
• Chain 'B':
  Compound: 5'-r(p*cp*cp*up*cp*cp*gp*u)-3'
  
• Heterogens: ZN

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wwfA (A:)
  atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll
  

  
  
• Chain 'B':
  No sequence available.