PDB entry 1wwe

View 1wwe on RCSB PDB site
Description: NMR Structure Determined for MLV NC complex with RNA Sequence UUUUGCU
Class: Viral protein/RNA
Keywords: Hydrophobic Guanosine Binding Pocket, Viral protein/RNA COMPLEX
Deposited on 2005-01-05, released 2005-03-22
The last revision prior to the SCOPe 2.01 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Nucleoprotein p10
    Species: Murine leukemia virus [TaxId:11801]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.01: d1wwea1
  • Chain 'B':
    Compound: 5'-r(p*up*up*up*up*gp*cp*u)-3'
  • Heterogens: ZN

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wweA (A:)
    atvvsgqkqdrqggerrrsqldrdqcayckekghwakdcpkkprgprgprpqtsll
    

  • Chain 'B':
    No sequence available.