PDB entry 1wwc

View 1wwc on RCSB PDB site
Description: nt3 binding domain of human trkc receptor
Class: transferase
Keywords: trk receptor, receptor tyrosine kinase, 3d-domain swapping, transferase
Deposited on 1999-04-30, released 1999-07-07
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.187
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (nt-3 growth factor receptor trkc)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q16288
      • mutation (105)
    Domains in SCOPe 2.06: d1wwca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wwcA (A:)
valtvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqeg
eisegcllfnkpthynngnytliaknplgtanqtinghflkepfpvdevsptppitvt

    Sequence, based on observed residues (ATOM records): (download) 
    >1wwcA (A:)
tvyypprvvsleepelrlehciefvvrgnppptlhwlhngqplreskiihveyyqegeis
egcllfnkpthynngnytliaknplgtanqtinghflkepfpvde