PDB entry 1wwb

View 1wwb on RCSB PDB site
Description: ligand binding domain of human trkb receptor
Class: transferase
Keywords: trk receptor, receptor tyrosine kinase, 3d-domain swapping, transferase
Deposited on 1999-05-03, released 1999-07-07
The last revision prior to the SCOPe 2.03 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.247
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'X':
  Compound: PROTEIN (Brain Derived Neurotrophic Factor Receptor TrkB)
  Species: Homo sapiens [TaxId:9606]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q16620 (0-102)
  Domains in SCOPe 2.03: d1wwbx_
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'X':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wwbX (X:)
  vhfaptitflesptsdhhwcipftvkgnpkpalqwfyngailneskyictkihvtnhtey
  hgclqldnpthmnngdytliakneygkdekqisahfmgwpgid