PDB entry 1wwa

View 1wwa on RCSB PDB site
Description: ngf binding domain of human trka receptor
Class: transferase
Keywords: trk receptor, receptor tyrosine kinase, 3d-domain swapping, transferase
Deposited on 1999-04-29, released 1999-07-07
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.207
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'X':
    Compound: protein (nerve growth factor receptor trka)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wwax_
  • Chain 'Y':
    Compound: protein (nerve growth factor receptor trka)
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wway_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'X':
    Sequence, based on SEQRES records: (download)
    >1wwaX (X:)
    vqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaa
    netvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwaX (X:)
    vsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaanetv
    rhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefn
    

  • Chain 'Y':
    Sequence, based on SEQRES records: (download)
    >1wwaY (Y:)
    vqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaa
    netvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnpfefn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wwaY (Y:)
    vqvnvsfpasvqlhtavemhhwcipfsvdgqpapslrwlfngsvlnetsfifteflepaa
    netvrhgclrlnqpthvnngnytllaanpfgqasasimaafmdnp