PDB entry 1ww9

View 1ww9 on RCSB PDB site
Description: Crystal structure of the terminal oxygenase component of carbazole 1,9a-dioxygenase, a non-heme iron oxygenase system catalyzing the novel angular dioxygenation for carbazole and dioxin
Class: oxidoreductase
Keywords: Terminal oxygenase, Carbazole 1, 9a-dioxygenase, Angular dioxygenase, Rieske non-heme iron oxygenase system, OXIDOREDUCTASE
Deposited on 2005-01-05, released 2005-08-23
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: terminal oxygenase component of carbazole
    Species: Janthinobacterium sp. J3 [TaxId:213804]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q84II6 (0-383)
      • expression tag (384-388)
    Domains in SCOPe 2.08: d1ww9a1, d1ww9a2, d1ww9a3
  • Heterogens: FE2, FES, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1ww9A (A:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ww9A (A:)
    manvdeailkrvkgwapyvdaklgfrnhwypvmfskeinegepktlkllgenllvnridg
    klyclkdrclhrgvqlsvkvecktkstitcwyhawtyrwedgvlcdiltnptsaqigrqk
    lktypvqeakgcvfiylgdgdppplardtppnfldddmeilgknqiiksnwrlavengfd
    pshiyihkdsilvkdndlalplgfapggdrkqqtrvvdddvvgrkgvydligehgvpvfe
    gtiggevvregaygekivandisiwlpgvlkvnpfpnpdmmqfewyvpidenthyyfqtl
    gkpcandeerkkyeqefeskwkpmalegfnnddiwareamvdfyaddkgwvneilfesde
    aivawrklasehnqgiqtqahvsglehhh