PDB entry 1ww8

View 1ww8 on RCSB PDB site
Description: Crystal Structure of malic enzyme from Pyrococcus horikoshii Ot3
Deposited on 2005-01-04, released 2006-03-21
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.19
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Malate oxidoreductase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • GB NP_143165 (0-End)
      • modified residue (0)
      • modified residue (89)
      • modified residue (108)
      • modified residue (285)
      • modified residue (350)
      • modified residue (392)
  • Chain 'B':
    Compound: Malate oxidoreductase
    Species: Pyrococcus horikoshii [TaxId:53953]
    Database cross-references and differences (RAF-indexed):
    • GB NP_143165
      • modified residue (89)
      • modified residue (108)
      • modified residue (285)
      • modified residue (350)
      • modified residue (392)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1ww8A (A:)
    mirekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeyt
    skgnlvavvsdgsrilglgnigplaglpvmegkallfkrfggvdafpimikeqepnkfid
    ivkaiaptfgginlediaspkcfyilerlreeldipvfhddqqgtaavvlagllnalkvv
    gkkiseitlalfgagaagfatlrilteagvkpenvrvvelvngkpriltsdldleklfpy
    rgwllkktngenieggpqealkdadvlisftrpgpgvikpqwiekmnedaivfplanpvp
    eilpeeakkagarivatgrsdypnqinnllgfpgifrgaldvrartitdsmiiaaakaia
    siveepseeniipsplnpivyarearavaeeamkegvartkvkgewveehtirliefyen
    viapinkkrreyskaitra
    

    Sequence, based on observed residues (ATOM records):
    >1ww8A (A:)
    mirekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeyt
    skgnlvavvsdgsrilglgnigplaglpvmegkallfkrfggvdafpimikeqepnkfid
    ivkaiaptfgginlediaspkcfyilerlreeldipvfhddqqgtaavvlagllnalkvv
    gkkiseitlalfgagaagfatlrilteagvkpenvrvvelvngkpriltsdldleklfpy
    rgwllkktngenieggpqealkdadvlisftrpgpgvikpqwiekmnedaivfplanpvp
    eilpeeakkagarivatgrsdypnqinnllgfpgifrgaldvrartitdsmiiaaakaia
    siveepseeniipsplnpivyarearavaeeamkegvartkvkgewveehtirliefyen
    viapinkkrreys
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1ww8B (B:)
    mirekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeyt
    skgnlvavvsdgsrilglgnigplaglpvmegkallfkrfggvdafpimikeqepnkfid
    ivkaiaptfgginlediaspkcfyilerlreeldipvfhddqqgtaavvlagllnalkvv
    gkkiseitlalfgagaagfatlrilteagvkpenvrvvelvngkpriltsdldleklfpy
    rgwllkktngenieggpqealkdadvlisftrpgpgvikpqwiekmnedaivfplanpvp
    eilpeeakkagarivatgrsdypnqinnllgfpgifrgaldvrartitdsmiiaaakaia
    siveepseeniipsplnpivyarearavaeeamkegvartkvkgewveehtirliefyen
    viapinkkrreyskaitra
    

    Sequence, based on observed residues (ATOM records):
    >1ww8B (B:)
    rekalefhknnfpgngkievipkvslesreeltlaytpgvaepckeiardpgkvyeytsk
    gnlvavvsdgsrilglgnigplaglpvmegkallfkrfggvdafpimikeqepnkfidiv
    kaiaptfgginlediaspkcfyilerlreeldipvfhddqqgtaavvlagllnalkvvgk
    kiseitlalfgagaagfatlrilteagvkpenvrvvelvngkpriltsdldleklfpyrg
    wllkktngenieggpqealkdadvlisftrpgpgvikpqwiekmnedaivfplanpvpei
    lpeeakkagarivatgrsdypnqinnllgfpgifrgaldvrartitdsmiiaaakaiasi
    veepseeniipsplnpivyarearavaeeamkegvartkvkgewveehtirliefyenvi
    apinkkrreyska