PDB entry 1ww7

View 1ww7 on RCSB PDB site
Description: Agrocybe cylindracea galectin (Ligand-free)
Class: sugar binding protein
Keywords: Agrocybe cylindracea galectin, fungal galectin, carbohydrate recognition domain,X-ray crystallographic analysis, sulfate ion, SUGAR BINDING PROTEIN
Deposited on 2005-01-03, released 2005-08-23
The last revision prior to the SCOPe 2.05 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.203
AEROSPACI score: 0.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW7 (0-159)
    Domains in SCOPe 2.05: d1ww7a_
  • Chain 'B':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW7 (0-159)
    Domains in SCOPe 2.05: d1ww7b_
  • Chain 'C':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW7 (0-159)
    Domains in SCOPe 2.05: d1ww7c_
  • Chain 'D':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW7 (0-159)
    Domains in SCOPe 2.05: d1ww7d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww7A (A:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww7B (B:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww7C (C:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww7D (D:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla