PDB entry 1ww6

View 1ww6 on RCSB PDB site
Description: Agrocybe cylindracea galectin complexed with lactose
Class: sugar binding protein
Keywords: Agrocybe cylindracea galectin, fungal galectin, carbohydrate recognition domain, lactose, X-ray crystallographic analysis, SUGAR BINDING PROTEIN
Deposited on 2005-01-03, released 2005-08-23
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-07-21, with a file datestamp of 2009-07-17.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.216
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW6 (0-159)
    Domains in SCOPe 2.06: d1ww6a_
  • Chain 'B':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW6 (0-159)
    Domains in SCOPe 2.06: d1ww6b_
  • Chain 'C':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW6 (0-159)
    Domains in SCOPe 2.06: d1ww6c_
  • Chain 'D':
    Compound: galectin
    Species: Agrocybe cylindracea [TaxId:64608]
    Gene:
    Database cross-references and differences (RAF-indexed):
    • PDB 1WW6 (0-159)
    Domains in SCOPe 2.06: d1ww6d_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww6A (A:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww6B (B:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww6C (C:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ww6D (D:)
    ttsavniynisagasvdlaapvttgdivtffssalnlsagagspnntalnllsengayll
    hiafrlqenvivfnsrqpnapwlveqrvsnvanqfigsggkamvtvfdhgdkyqvvinek
    tviqytkqisgttsslsynstegtsifstvveavtytgla