PDB entry 1wvz

View 1wvz on RCSB PDB site
Description: Solution Structure of the D2 Domain of the Fibroblast Growth Factor
Class: transferase
Keywords: Fibroblast Growth Factor receptor, heparin, tumor, angiogenesis, TRANSFERASE
Deposited on 2004-12-28, released 2005-12-28
The last revision prior to the SCOPe 2.06 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Fibroblast growth factor receptor 2
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wvza_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvzA (A:)
    mnsnnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehrig
    gykvrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvzA (A:)
    nnkrapywtntekmekrlhavpaantvkfrcpaggnpmptmrwlkngkefkqehriggyk
    vrnqhwslimesvvpsdkgnytcvveneygsinhtyhldvv