PDB entry 1wvx

View 1wvx on RCSB PDB site
Description: Crystal structures of kinase domain of DAP kinase in complex with small molecular inhibitors
Class: Transferase
Keywords: protein kinase, apoptosis, staurosporine, Transferase
Deposited on 2004-12-27, released 2006-04-11
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.225
AEROSPACI score: 0.28 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Death-associated protein kinase 1
    Species: Homo sapiens [TaxId:9606]
    Gene:
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d1wvxa_
  • Heterogens: BD4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvxA (A:)
    mtvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsred
    ierevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeatefl
    kqilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgt
    pefvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedey
    fsntsalakdfirrllvkdpkkrmtiqdslqhpwikpk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvxA (A:)
    tvfrqenvddyydtgeelgsgqfavvkkcrekstglqyaakfikkrrtkssrrgvsredi
    erevsilkeiqhpnvitlhevyenktdvililelvaggelfdflaekeslteeeateflk
    qilngvyylhslqiahfdlkpenimlldrnvpkprikiidfglahkidfgnefknifgtp
    efvapeivnyeplgleadmwsigvityillsgaspflgdtkqetlanvsavnyefedeyf
    sntsalakdfirrllvkdpkkrmtiqdslqhpwik