PDB entry 1wvu

View 1wvu on RCSB PDB site
Description: Crystal structure of chitinase C from Streptomyces griseus HUT6037
Class: hydrolase
Keywords: family 19 chitinase, whole structure, HYDROLASE
Deposited on 2004-12-27, released 2005-12-27
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.45 Å
R-factor: 0.175
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: chitinase C
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed):
    • GB BAA23739 (Start-264)
    Domains in SCOPe 2.07: d1wvua_
  • Chain 'B':
    Compound: chitinase C
    Species: Streptomyces griseus [TaxId:1911]
    Database cross-references and differences (RAF-indexed):
    • GB BAA23739 (Start-264)
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvuA (A:)
    atcatawssssvytnggtvsyngrnytakwwtqnerpgtsdvwadkgacgtggegpggnn
    gfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvshetg
    glfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalginllan
    pylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecnggnpaq
    vqsrinkftqftqilgtttgpnlsc
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvuA (A:)
    ggnngfvvseaqfnqmfpnrnafytykgltdalsaypafaktgsdevkkreaaaflanvs
    hetgglfyikevneanyphycdttqsygcpagqaayygrgpiqlswnfnykaagdalgin
    llanpylveqdpavawktglwywnsqngpgtmtphnaivnnagfgetirsingalecngg
    npaqvqsrinkftqftqilgtttgpnlsc
    

  • Chain 'B':
    No sequence available.