PDB entry 1wvt

View 1wvt on RCSB PDB site
Description: Crystal structure of uncharacterized protein ST2180 from Sulfolobus tokodaii
Class: structural genomics, unknown function
Keywords: structural genomics, unknown function
Deposited on 2004-12-27, released 2006-01-03
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-05-01, with a file datestamp of 2013-04-26.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.221
AEROSPACI score: 0.36 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein ST2180
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST2180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvta_
  • Chain 'B':
    Compound: hypothetical protein ST2180
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST2180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvtb_
  • Chain 'C':
    Compound: hypothetical protein ST2180
    Species: Sulfolobus tokodaii [TaxId:273063]
    Gene: ST2180
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvtc_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvtA (A:)
    mwytgtgdkgktkvpsvgevwkdseivkalgdldelnsvlgvvsslypelseviqklqnd
    ifsisseiagfdmnfsdekvkgieelitnyskeleplrnfvlpgghiassflhlaravcr
    raersvvtllkeskakevhakylnrlssllfvlalvvnkrtnnpnviwrgkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvtA (A:)
    kdseivkalgdldelnsvlgvvsslypelseviqklqndifsisseiagfdmnfsdekvk
    gieelitnyskeleplrnfvlpgghiassflhlaravcrraersvvtllkeskakevhak
    ylnrlssllfvlalvvnkrtnnpnviwr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wvtB (B:)
    mwytgtgdkgktkvpsvgevwkdseivkalgdldelnsvlgvvsslypelseviqklqnd
    ifsisseiagfdmnfsdekvkgieelitnyskeleplrnfvlpgghiassflhlaravcr
    raersvvtllkeskakevhakylnrlssllfvlalvvnkrtnnpnviwrgkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvtB (B:)
    dseivkalgdldelnsvlgvvsslypelseviqklqndifsisseiagfdmnfsdekvkg
    ieelitnyskeleplrnfvlpgghiassflhlaravcrraersvvtllkeskakevhaky
    lnrlssllfvlalvvnkrtnnpnviwr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wvtC (C:)
    mwytgtgdkgktkvpsvgevwkdseivkalgdldelnsvlgvvsslypelseviqklqnd
    ifsisseiagfdmnfsdekvkgieelitnyskeleplrnfvlpgghiassflhlaravcr
    raersvvtllkeskakevhakylnrlssllfvlalvvnkrtnnpnviwrgkd
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvtC (C:)
    dseivkalgdldelnsvlgvvsslypelseviqklqndifsisseiagfdmnfsdekvkg
    ieelitnyskeleplrnfvlpgghiassflhlaravcrraersvvtllkeskakevhaky
    lnrlssllfvlalvvnkrtnnpnviw