PDB entry 1wvr

View 1wvr on RCSB PDB site
Description: Crystal Structure of a CRISP family Ca-channel blocker derived from snake venom
Class: toxin
Keywords: cysteine-rich secretory protein, TOXIN
Deposited on 2004-12-24, released 2005-07-05
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Triflin
    Species: Trimeresurus flavoviridis [TaxId:88087]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wvra1, d1wvra2
  • Heterogens: CD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wvrA (A:)
nvdfdsesprkpeiqneiidlhnslrrsvnptasnmlkmewypeaaanaerwayrciesh
ssrdsrviggikcgeniymatypakwtdiihawhgeykdfkygvgavpsdavighytqiv
wyksyragcaaaycpsskysyfyvcqycpagniigktatpyksgppcgdcpsdcdnglct
npctreneftncdslvqksscqdnymkskcpascfcqnkii