PDB entry 1wvq

View 1wvq on RCSB PDB site
Description: Structure of conserved hypothetical protein PAE2307 from Pyrobaculum aerophilum
Class: structural genomics, unknown function
Keywords: Phosphorylated histidine, STRUCTURAL GENOMICS, UNKNOWN FUNCTION
Deposited on 2004-12-24, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.45 Å
R-factor: 0.207
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein pae2307
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2307
    Database cross-references and differences (RAF-indexed):
    • GB NP_559917 (Start-166)
    Domains in SCOPe 2.07: d1wvqa_
  • Chain 'B':
    Compound: hypothetical protein pae2307
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2307
    Database cross-references and differences (RAF-indexed):
    • GB NP_559917 (Start-166)
    Domains in SCOPe 2.07: d1wvqb_
  • Chain 'C':
    Compound: hypothetical protein pae2307
    Species: Pyrobaculum aerophilum [TaxId:13773]
    Gene: PAE2307
    Database cross-references and differences (RAF-indexed):
    • GB NP_559917 (Start-166)
    Domains in SCOPe 2.07: d1wvqc_
  • Heterogens: PO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvqA (A:)
    mtdmsikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrl
    vrheandeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanpl
    kvivaeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvqA (A:)
    sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe
    andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv
    aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wvqB (B:)
    mtdmsikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrl
    vrheandeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanpl
    kvivaeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvqB (B:)
    sikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhe
    andeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviv
    aeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wvqC (C:)
    mtdmsikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrl
    vrheandeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanpl
    kvivaeveperrgvvgvvdghsplgvetekdreerkkflrevvkykl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvqC (C:)
    ikfelidvpipqgtnviigqahfiktvedlyealvtsvpgvkfgiafceasgkrlvrhea
    ndeelrnlaidlckkiaaghvfviyirnawpinvlnaiknvpevvrifaatanplkviva
    eveperrgvvgvvdghsplgvetekdreerkkflrevvkykl