PDB entry 1wvp

View 1wvp on RCSB PDB site
Description: Structure of chemically modified myoglobin with distal N-tetrazolyl-histidine E7(64)
Class: oxygen storage/transport
Keywords: myoglobin, HEMOPROTEIN, Tetrazole, chemical modification, distal HisE7, oxygen carrier, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Structural Genomics
Deposited on 2004-12-23, released 2005-01-18
The last revision prior to the SCOP 1.73 freeze date was dated 2005-01-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.53 Å
R-factor: 0.175
AEROSPACI score: 0.64 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Myoglobin
    Species: Physeter catodon
    Database cross-references and differences (RAF-indexed):
    • Uniprot P02185 (0-End)
      • modified residue (63)
    Domains in SCOP 1.73: d1wvpa1
  • Heterogens: SO4, HEM, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wvpA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgyqg

    Sequence, based on observed residues (ATOM records): (download) 
    >1wvpA (A:)
vlsegewqlvlhvwakveadvaghgqdilirlfkshpetlekfdrfkhlkteaemkased
lkkhgvtvltalgailkkkghheaelkplaqshatkhkipikylefiseaiihvlhsrhp
gdfgadaqgamnkalelfrkdiaakykelgy