PDB entry 1wvo

View 1wvo on RCSB PDB site
Description: Solution structure of RSGI RUH-029, an antifreeze protein like domain in human N-acetylneuraminic acid phosphate synthase gene.
Deposited on 2004-12-22, released 2006-01-03
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Sialic acid synthase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9NR45 (7-72)
      • cloning artifact (0-6)
      • cloning artifact (73-78)

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records:
    >1wvoA (A:)
    gssgssgsvvakvkipegtiltmdmltvkvgepkgyppedifnlvgkkvlvtveeddtim
    eelvdnhgkkikssgpssg