PDB entry 1wvn

View 1wvn on RCSB PDB site
Description: Crsytal Structure of domain 3 of human alpha polyC binding protein
Class: RNA binding protein
Keywords: KH Domain, RNA binding domain
Deposited on 2004-12-17, released 2005-04-05
The last revision prior to the SCOP 1.73 freeze date was dated 2005-04-05, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.214
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Poly(rC)-binding protein 1
    Species: HOMO SAPIENS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q15365 (4-End)
      • cloning artifact (0-3)
    Domains in SCOP 1.73: d1wvna1
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download) 
    >1wvnA (A:)
plgsqttheltipnnligciigrqganineirqmsgaqikianpvegssgrqvtitgsaa
sislaqylinarlssekgmgcs

    Sequence, based on observed residues (ATOM records): (download) 
    >1wvnA (A:)
plgsqttheltipnnligciigrqganineirqmsgaqikianpvegssgrqvtitgsaa
sislaqylinarls