PDB entry 1wvm

View 1wvm on RCSB PDB site
Description: Crystal Structure of Psychrophilic Subtilisin-like Serine Protease APA1 from Antarctic Psychrotroph Pseudoaleromonas sp. AS-11, Complexed with Inhibitor Chymostatin
Class: hydrolase/hydrolase inhibitor
Keywords: subtilisin-like alpha/beta domain, insert beta barrel domain, HYDROLASE, HYDROLASE-HYDROLASE INHIBITOR COMPLEX
Deposited on 2004-12-16, released 2006-03-21
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.6 Å
R-factor: 0.192
AEROSPACI score: 0.57 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alkaline serine protease
    Species: Pseudoalteromonas sp. [TaxId:247492]
    Database cross-references and differences (RAF-indexed):
    • GB BAD51450 (0-End)
    Domains in SCOPe 2.07: d1wvma_
  • Chain 'B':
    Compound: Alkaline serine protease
    Species: Pseudoalteromonas sp. [TaxId:247492]
    Database cross-references and differences (RAF-indexed):
    • GB BAD51450 (0-End)
    Domains in SCOPe 2.07: d1wvmb_
  • Chain 'C':
    Compound: Chymostatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1WVM (0-3)
  • Chain 'D':
    Compound: Chymostatin
    Database cross-references and differences (RAF-indexed):
    • PDB 1WVM (0-3)
  • Heterogens: CA, MG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvmA (A:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgptdpgtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvmA (A:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgp
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wvmB (B:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgptdpgtg
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvmB (B:)
    aettpwgqtfvgatvlsdsqagnrticiidsgydrshndlnannvtgtnnsgtgnwyqpg
    nnnahgthvagtiaaiannegvvgvmpnqnanihivkvfneagwgyssslvaaidtcvns
    gganvvtmslggsgsttternalnthynngvlliaaagnagdssysypasydsvmsvaav
    dsnldhaafsqytdqveisgpgeailstvtvgegrladitiggqsyfsngvvphnrltps
    gtsyapapinasatgalaectvngtsfscgnmankiclvervgnqgssypeinstkackt
    agakgiivysnsalpglqnpflvdansditvpsvsvdratglalkaklgqsttvsnqgnq
    dyeyyngtsmatphvsgvatlvwsyhpecsasqvraalnataddlsvagrdnqtgygmin
    avaakayldesctgpt
    

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.