PDB entry 1wvl

View 1wvl on RCSB PDB site
Description: Crystal Structure of Multimeric DNA-binding Protein Sac7d-GCN4 with DNA decamer
Class: structural protein/DNA
Keywords: leucine zipper, protein engineering, synchrotron radiation, thermophile, x-ray crystallography, STRUCTURAL PROTEIN/DNA COMPLEX
Deposited on 2004-12-16, released 2005-08-02
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA-binding proteins 7a/7b/7d, GCN4
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123 (0-65)
    • PDB 1WVL (0-79)
    Domains in SCOPe 2.07: d1wvla_
  • Chain 'B':
    Compound: DNA-binding proteins 7a/7b/7d, GCN4
    Species: Sulfolobus acidocaldarius [TaxId:2285]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P13123 (0-65)
    • PDB 1WVL (0-79)
    Domains in SCOPe 2.07: d1wvlb_
  • Chain 'C':
    Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  • Chain 'D':
    Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wvlA (A:)
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekkgvlkklravenelh

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >1wvlB (B:)
mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
aerekkgvlkklravenelh

  • Chain 'C':
    No sequence available.

  • Chain 'D':
    No sequence available.