PDB entry 1wvl

View 1wvl on RCSB PDB site
Description: Crystal Structure of Multimeric DNA-binding Protein Sac7d-GCN4 with DNA decamer
Class: structural protein/DNA
Keywords: leucine zipper, protein engineering, synchrotron radiation, thermophile, x-ray crystallography
Deposited on 2004-12-16, released 2005-08-02
The last revision prior to the SCOP 1.73 freeze date was dated 2005-08-30, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: 0.23
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA-binding proteins 7a/7b/7d, GCN4
  Species: Sulfolobus acidocaldarius
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (0-65)
  Domains in SCOP 1.73: d1wvla1
• Chain 'B':
  Compound: DNA-binding proteins 7a/7b/7d, GCN4
  Species: Sulfolobus acidocaldarius
  Database cross-references and differences (RAF-indexed):
  • Uniprot P13123 (0-65)
  Domains in SCOP 1.73: d1wvlb1
• Chain 'C':
  Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  
• Chain 'D':
  Compound: 5'-d(*cp*cp*tp*ap*tp*ap*tp*ap*gp*g)-3'
  
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wvlA (A:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekkgvlkklravenelh
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wvlB (B:)
  mvkvkfkykgeekevdtskikkvwrvgkmvsftyddngktgrgavsekdapkelldmlar
  aerekkgvlkklravenelh
  

  
  
• Chain 'C':
  No sequence available.
  
  
• Chain 'D':
  No sequence available.