PDB entry 1wvi

View 1wvi on RCSB PDB site
Description: Crystal structure of putative phosphatase from Streptococcus mutans UA159
Class: structural genomics, unknown function
Keywords: Structural genomics, protein structure initiative, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, target T1939, putative phosphatase, UNKNOWN FUNCTION
Deposited on 2004-12-15, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.248
AEROSPACI score: 0.31 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: putative phosphatases involved in N-acetyl-glucosamine catabolism
    Species: Streptococcus mutans [TaxId:210007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvia_
  • Chain 'B':
    Compound: putative phosphatases involved in N-acetyl-glucosamine catabolism
    Species: Streptococcus mutans [TaxId:210007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvib_
  • Chain 'C':
    Compound: putative phosphatases involved in N-acetyl-glucosamine catabolism
    Species: Streptococcus mutans [TaxId:210007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvic_
  • Chain 'D':
    Compound: putative phosphatases involved in N-acetyl-glucosamine catabolism
    Species: Streptococcus mutans [TaxId:210007]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvid_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wviA (A:)
    mtykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsf
    niktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgl
    dtnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiig
    kpeavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpi
    qpdfvlsslaewdfder
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wviA (A:)
    tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn
    iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld
    tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk
    peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq
    pdfvlsslaewdf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wviB (B:)
    mtykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsf
    niktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgl
    dtnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiig
    kpeavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpi
    qpdfvlsslaewdfder
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wviB (B:)
    tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn
    iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld
    tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk
    peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq
    pdfvlsslaewdf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wviC (C:)
    mtykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsf
    niktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgl
    dtnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiig
    kpeavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpi
    qpdfvlsslaewdfder
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wviC (C:)
    tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn
    iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld
    tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk
    peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq
    pdfvlsslaewdf
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wviD (D:)
    mtykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsf
    niktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgl
    dtnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiig
    kpeavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpi
    qpdfvlsslaewdfder
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wviD (D:)
    tykgylidldgtiykgkdripagedfvkrlqerqlpyilvtnnttrtpemvqemlatsfn
    iktpletiytatlatidymndmkrgktayvigetglkkavaeagyredsenpayvvvgld
    tnltyekltlatlaiqkgavfigtnpdlniptergllpgagailfllekatrvkpiiigk
    peavimnkaldrlgvkrheaimvgdnyltditagikndiatllvttgftkpeevpalpiq
    pdfvlsslaewdf