PDB entry 1wvg

View 1wvg on RCSB PDB site
Description: Structure of CDP-D-glucose 4,6-dehydratase from Salmonella typhi
Class: lyase
Keywords: short-chain dehydrogenase/reductase, Rossmann fold, LYASE
Deposited on 2004-12-15, released 2005-01-26
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.203
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: CDP-glucose 4,6-dehydratase
    Species: Salmonella enterica [TaxId:220341]
    Gene: ddhB
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvga1
  • Chain 'B':
    Compound: CDP-glucose 4,6-dehydratase
    Species: Salmonella enterica [TaxId:220341]
    Gene: ddhB
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26397 (0-End)
      • conflict (0)
    Domains in SCOPe 2.07: d1wvgb_
  • Heterogens: APR, CXY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvgA (A:)
    sidknfwqgkrvfvtghtgfkgswlslwltemgaivkgyaldaptvpslfeivrlndlme
    shigdirdfeklrssiaefkpeivfhmaaqplvrlsyeqpiktystnvmgtvhlletvkq
    vgnikavvnitsdkcydnrewvwgyrenepmggydpysnskgcaelvasafrnsffnpan
    yeqhgvglasvragnvigggdwakdrlipdilrsfennqqviirnpysirpwqhvlepls
    gyivvaqrlytegakfsegwnfgprdedaktvefivdkmvtlwgddaswlldgenhphea
    hylkldcskanmqlgwhprwgltetlsrivkwhkawirgedmlicskreisdymsattr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvgA (A:)
    sidknfwqgkrvfvtghtgfkgswlslwltemgaivkgyaldaptvpslfeivrlndlme
    shigdirdfeklrssiaefkpeivfhmaaqplvrlsyeqpiktystnvmgtvhlletvkq
    vgnikavvnitsdkcydnrewvwgyrenepmggydpysnskgcaelvasafrnsffnpan
    yeqhgvglasvragnvigggdwakdrlipdilrsfennqqviirnpysirpwqhvlepls
    gyivvaqrlytegakfsegwnfgprdedaktvefivdkmvtlwgddaswlldpheahylk
    ldcskanmqlgwhprwgltetlsrivkwhkawirgedmlicskreisdymsa
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wvgB (B:)
    sidknfwqgkrvfvtghtgfkgswlslwltemgaivkgyaldaptvpslfeivrlndlme
    shigdirdfeklrssiaefkpeivfhmaaqplvrlsyeqpiktystnvmgtvhlletvkq
    vgnikavvnitsdkcydnrewvwgyrenepmggydpysnskgcaelvasafrnsffnpan
    yeqhgvglasvragnvigggdwakdrlipdilrsfennqqviirnpysirpwqhvlepls
    gyivvaqrlytegakfsegwnfgprdedaktvefivdkmvtlwgddaswlldgenhphea
    hylkldcskanmqlgwhprwgltetlsrivkwhkawirgedmlicskreisdymsattr
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvgB (B:)
    sidknfwqgkrvfvtghtgfkgswlslwltemgaivkgyaldaptvpslfeivrlndlme
    shigdirdfeklrssiaefkpeivfhmaaqplvrlsyeqpiktystnvmgtvhlletvkq
    vgnikavvnitsdkcydnrewvwgyrenepmggydpysnskgcaelvasafrnsffnpan
    qhgvglasvragnvigggdwakdrlipdilrsfennqqviirnpysirpwqhvleplsgy
    ivvaqrlytegakfsegwnfgprdedaktvefivdkmvtlwgdaswlldgenhphhylkl
    dcskanmqlgwhprwgltetlsrivkwhkawirgedmlicskreisdyms