PDB entry 1wvf

View 1wvf on RCSB PDB site
Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
Class: oxidoreductase
Keywords: flavoprotein, electron-transfer, fad, oxidoreductase
Deposited on 2004-12-15, released 2005-03-08
The last revision prior to the SCOPe 2.06 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.146
AEROSPACI score: 0.77 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.06: d1wvfa1, d1wvfa2
  • Heterogens: CL, FAD, ACY, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvfA (A:)
    seqnnavlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaa
    vtattveqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidp
    emcyalvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmm
    qcgmevvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpk
    ppvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttep
    ghtpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagd
    tqpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkyg
    ldyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqd
    rvaqsygpvkrklehaikravdpnnilapgrsgidlnndf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvfA (A:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf