PDB entry 1wve

View 1wve on RCSB PDB site
Description: p-Cresol Methylhydroxylase: Alteration of the Structure of the Flavoprotein Subunit upon its Binding to the Cytochrome Subunit
Class: oxidoreductase
Keywords: flavocytochrome, electron-transfer, fad, heme, oxidoreductase
Deposited on 2004-12-15, released 2005-03-08
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.85 Å
R-factor: 0.159
AEROSPACI score: 0.53 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvea1, d1wvea2
  • Chain 'B':
    Compound: 4-cresol dehydrogenase [hydroxylating] flavoprotein subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wveb1, d1wveb2
  • Chain 'C':
    Compound: 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wvec_
  • Chain 'D':
    Compound: 4-cresol dehydrogenase [hydroxylating] cytochrome c subunit
    Species: Pseudomonas putida [TaxId:303]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wved_
  • Heterogens: CL, FAD, TRS, HEM, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wveA (A:)
    seqnnavlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaa
    vtattveqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidp
    emcyalvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmm
    qcgmevvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpk
    ppvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttep
    ghtpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagd
    tqpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkyg
    ldyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqd
    rvaqsygpvkrklehaikravdpnnilapgrsgidlnndf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wveA (A:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wveB (B:)
    seqnnavlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaa
    vtattveqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidp
    emcyalvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmm
    qcgmevvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpk
    ppvfkpfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttep
    ghtpdsvikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagd
    tqpfkyraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkyg
    ldyvaefivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqd
    rvaqsygpvkrklehaikravdpnnilapgrsgidlnndf
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wveB (B:)
    avlpkgvtqgefnkavqkfrallgddnvlvesdqlvpynkimmpvenaahapsaavtatt
    veqvqgvvkicnehkipiwtistgrnfgygsaapvqrgqvildlkkmnkiikidpemcya
    lvepgvtfgqmydyiqennlpvmlsfsapsaiagpvgntmdrgvgytpygehfmmqcgme
    vvlangdvyrtgmggvpgsntwqifkwgygptldgmftqanygictkmgfwlmpkppvfk
    pfevifedeadiveivdalrplrmsntipnsvviastlweagsahltraqyttepghtpd
    svikqmqkdtgmgawnlyaalygtqeqvdvnwkivtdvfkklgkgrivtqeeagdtqpfk
    yraqlmsgvpnlqefglynwrggggsmwfapvseargseckkqaamakrvlhkygldyva
    efivaprdmhhvidvlydrtnpeetkradacfnelldefekegyavyrvntrfqdrvaqs
    ygpvkrklehaikravdpnnilapgrsgidlnndf
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wveC (C:)
    dsqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdd
    esltqvaeylsslpapaaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wveC (C:)
    sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
    sltqvaeylsslpap
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wveD (D:)
    dsqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdd
    esltqvaeylsslpapaaqp
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wveD (D:)
    sqwgsgknlydkvcghchkpevgvgpvlegrglpeayikdivrngframpafpasyvdde
    sltqvaeylsslpap