PDB entry 1wvc

View 1wvc on RCSB PDB site
Description: alpha-D-glucose-1-phosphate cytidylyltransferase complexed with CTP
Class: transferase
Keywords: CDP-glucose pyrophosphorylase, nucleotidyltransferase, TRANSFERASE
Deposited on 2004-12-14, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.202
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glucose-1-phosphate cytidylyltransferase
    Species: Salmonella enterica subsp. enterica serovar Typhi [TaxId:220341]
    Gene: rfbF
    Database cross-references and differences (RAF-indexed):
    • Uniprot P26396 (3-258)
      • cloning artifact (1-2)
    Domains in SCOPe 2.08: d1wvca1, d1wvca2
  • Heterogens: MG, NI, CTP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvcA (A:)
    maskavilagglgtrlseetivkpkpmveiggkpilwhimkmysvhgikdfiiccgykgy
    vikeyfanyflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvk
    ddeaflftygdgvadldikatidfhkahgkkatltatfppgrfgaldiqagqvrsfqekp
    kgdgaminggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrd
    kvyleglwekgkapwktwe
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvcA (A:)
    askavilagglgtrlseetivkpkpmveiggkpilwhimkmysvhgikdfiiccgykgyv
    ikeyfanyflhmsdvtfhmaenrmevhhkrvepwnvtlvdtgdssmtggrlkrvaeyvkd
    deaflftygdgvadldikatidfhkahgkkatltatfppgrgaldiqagqvrsfqkgdga
    minggffvlnpsvidlidndattweqeplmtlaqqgelmafehpgfwqpmdtlrdkvyle
    glwekgkapwktwe