PDB entry 1wva

View 1wva on RCSB PDB site
Description: Crystal structure of human arginase I from twinned crystal
Class: Hydrolase
Keywords: Hydrolase, twinned crystal, BEC inhibitor
Deposited on 2004-12-14, released 2005-09-06
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.94 Å
R-factor: 0.15
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: arginase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wvaa1
  • Chain 'B':
    Compound: arginase 1
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wvab_
  • Heterogens: MN, S2C, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wvaA (A:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvaA (A:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wvaB (B:)
    msaksrtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipn
    dspfqivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgv
    iwvdahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglr
    dvdpgehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsf
    tpatgtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavait
    lacfglaregnhkpidylnppk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wvaB (B:)
    srtigiigapfskgqprggveegptvlrkaglleklkeqecdvkdygdlpfadipndspf
    qivknprsvgkaseqlagkvaevkkngrislvlggdhslaigsisgharvhpdlgviwvd
    ahtdintpltttsgnlhgqpvsfllkelkgkipdvpgfswvtpcisakdivyiglrdvdp
    gehyilktlgikyfsmtevdrlgigkvmeetlsyllgrkkrpihlsfdvdgldpsftpat
    gtpvvggltyreglyiteeiyktgllsgldimevnpslgktpeevtrtvntavaitlacf
    glaregnhk