PDB entry 1wv9

View 1wv9 on RCSB PDB site
Description: Crystal Structure of Rhodanese Homolog TT1651 from an Extremely Thermophilic Bacterium Thermus thermophilus HB8
Deposited on 2004-12-12, released 2005-06-19
The last revision was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.215
AEROSPACI score: 0.38 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Rhodanese Homolog TT1651
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKN0
      • modified residue (80)
  • Chain 'B':
    Compound: Rhodanese Homolog TT1651
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q5SKN0 (0-End)
      • modified residue (0)
      • modified residue (80)
  • Heterogens: HOH

PDB Chain Sequences:
This PDB entry is not classified in SCOPe 2.07, so the chain sequences below are not included in the ASTRAL sequence sets.

  • Chain 'A':
    Sequence, based on SEQRES records:
    >1wv9A (A:)
    mrkvrpeelpalleegvlvvdvrpadrrstplpfaaewvplekiqkgehglprrplllvc
    ekgllsqvaalyleaegyeamslegglqaltqgk
    

    Sequence, based on observed residues (ATOM records):
    >1wv9A (A:)
    rkvrpeelpalleegvlvvdvrparstplpfaaewvplekiqkgehglprrplllvcekg
    llsqvaalyleaegyeamslegglqal
    

  • Chain 'B':
    Sequence, based on SEQRES records:
    >1wv9B (B:)
    mrkvrpeelpalleegvlvvdvrpadrrstplpfaaewvplekiqkgehglprrplllvc
    ekgllsqvaalyleaegyeamslegglqaltqgk
    

    Sequence, based on observed residues (ATOM records):
    >1wv9B (B:)
    mrkvrpeelpalleegvlvvdvrpastplpfaaewvplekiqkgehglprrplllvcekg
    llsqvaalyleaegyeamslegglqa