PDB entry 1wv8

View 1wv8 on RCSB PDB site
Description: Crystal structure of hypothetical protein TTHA1013 from an extremely thermophilic bacterium thermus thermophilus HB8
Class: structural genomics, unknown function
Keywords: Hypothetical, STRUCTURAL GENOMICS, Unknown function, novel fold, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-12-12, released 2005-06-12
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.259
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: hypothetical protein TTHA1013
  Species: Thermus thermophilus [TaxId:300852]
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q5SJJ5
    • modified residue (43)
  Domains in SCOPe 2.08: d1wv8a1
• Heterogens: HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence, based on SEQRES records: (download)
  

  >1wv8A (A:)
  mrtlkvqalwdgeagvwvaesddvpglateaatleellaklavmvpelleengvalelpv
  elrleatrplvfs
  

  
  Sequence, based on observed residues (ATOM records): (download)
  

  >1wv8A (A:)
  rtlkvqalwdgeagvwvaesddvpglateaatleellaklavmvpelleengvalelpve
  lrleatrplvf