PDB entry 1wv4

View 1wv4 on RCSB PDB site
Description: X-ray Structure of Escherichia coli pyridoxine 5'-phosphate oxidase in tetragonal crystal form
Class: oxidoreductase
Keywords: PLP, FMN, pyridoxal, pyridoxine 5'-phosphate, oxidase, OXIDOREDUCTASE
Deposited on 2004-12-11, released 2004-12-28
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 2.6 Å
R-factor: N/A
AEROSPACI score: 0.18 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Pyridoxamine 5'-phosphate oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wv4a_
  • Chain 'B':
    Compound: Pyridoxamine 5'-phosphate oxidase
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wv4b_
  • Heterogens: PO4, FMN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wv4A (A:)
    msdndelqqiahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvde
    hgqpyqrivllkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaer
    lstlevmkyfhsrprdsqigawvskqssrisargileskflelkqkfqqgevplpsfwgg
    frvsleqiefwqggehrlhdrflyqrendawkidrlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wv4A (A:)
    ahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivl
    lkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmkys
    fwggfrvsleqiefwqggehrlhdrflyqrendawkidrlap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wv4B (B:)
    msdndelqqiahlrreytkgglrrrdlpadpltlferwlsqaceakladptamvvatvde
    hgqpyqrivllkhydekgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaer
    lstlevmkyfhsrprdsqigawvskqssrisargileskflelkqkfqqgevplpsfwgg
    frvsleqiefwqggehrlhdrflyqrendawkidrlap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wv4B (B:)
    ytkgglrrrdlpadpltlferwlsqaceakladptamvvatvdehgqpyqrivllkhyde
    kgmvfytnlgsrkahqiennprvsllfpwhtlerqvmvigkaerlstlevmsfwggfrvs
    leqiefwqggehrlhdrflyqrendawkidrlap