PDB entry 1wv3

View 1wv3 on RCSB PDB site
Description: Crystal structure of N-terminal domain of hypothetical protein SAV0287 from Staphylococcus aureus
Class: structural genomics, unknown function
Keywords: ATPase, structural genomics, UNKNOWN FUNCTION
Deposited on 2004-12-10, released 2005-12-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-06-09, with a file datestamp of 2009-06-05.
Experiment type: XRAY
Resolution: 1.75 Å
R-factor: 0.195
AEROSPACI score: -3.47 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: similar to DNA segregation ATPase and related proteins
    Species: Staphylococcus aureus subsp. aureus Mu50 [TaxId:158878]
    Gene: SAV0287
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8NYF3 (0-End)
      • modified residue (0)
      • modified residue (13)
      • modified residue (93)
      • modified residue (103)
      • modified residue (109)
    Domains in SCOPe 2.07: d1wv3a1, d1wv3a2
  • Heterogens: CL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wv3A (A:)
    mhkliikynkqlkmlnlrdgktytisederaditlkslgevihleqnnqgtwqanhtsin
    kvlvrkgdldditlqlyteadyasfaypsiqdtmtigpnayddmviqslmnaiiikdfqs
    iqesqyvrivhdkntdvyinyelqeqltnkayigdhiyvegiwlevqadglnvlsqntva
    sslirltqemphaqaddyntyhrspriihreptddikierppqpiqknntlehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wv3A (A:)
    mhkliikynkqlkmlnlrdgktytisederaditlkslgevihleqnnqgtwqanhtsin
    kvlvrkgdldditlqlyteadyasfaypsiqdtmtigpnayddmviqslmnaiiikdfqs
    iqesqyvrivhdkntdvyinyelqeqltnkayigdhiyvegiwlevqadglnvlsqntva
    sslirl