PDB entry 1wuw

View 1wuw on RCSB PDB site
Description: Crystal Structure of beta hordothionin
Class: plant protein
Keywords: crambin fold, dimer, PLANT PROTEIN
Deposited on 2004-12-09, released 2005-01-11
The last revision prior to the SCOPe 2.08 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Beta-hordothionin
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21742
  Domains in SCOPe 2.08: d1wuwa_
• Chain 'B':
  Compound: Beta-hordothionin
  Species: Hordeum vulgare [TaxId:4513]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P21742 (0-44)
  Domains in SCOPe 2.08: d1wuwb_
• Heterogens: TSU, SER, HOH

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wuwA (A:)
  ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1wuwB (B:)
  ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk