PDB entry 1wuw

View 1wuw on RCSB PDB site
Description: Crystal Structure of beta hordothionin
Class: plant protein
Keywords: crambin fold, dimer, PLANT PROTEIN
Deposited on 2004-12-09, released 2005-01-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: N/A
AEROSPACI score: 0.33 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Beta-hordothionin
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuwa_
  • Chain 'B':
    Compound: Beta-hordothionin
    Species: Hordeum vulgare [TaxId:4513]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuwb_
  • Heterogens: TSU, SER, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wuwA (A:)
    ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wuwB (B:)
    ksccrstlgrncynlcrvrgaqklcanacrckltsglkcpssfpk