PDB entry 1wuv

View 1wuv on RCSB PDB site
Description: Crystal structure of native Canavalia gladiata lectin (CGL): a tetrameric ConA-like lectin
Class: plant protein
Keywords: beta sheet structure, native protein, plant protein
Deposited on 2004-12-09, released 2006-04-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.3 Å
R-factor: 0.186
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: concanavalin a
    Species: Canavalia gladiata [TaxId:3824]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuva_
  • Chain 'D':
    Compound: concanavalin a
    Species: Canavalia gladiata [TaxId:3824]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuvd_
  • Chain 'G':
    Compound: concanavalin a
    Species: Canavalia gladiata [TaxId:3824]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuvg_
  • Chain 'J':
    Compound: concanavalin a
    Species: Canavalia gladiata [TaxId:3824]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuvj_
  • Heterogens: MN, CA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wuvA (A:)
    adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wuvD (D:)
    adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'G':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wuvG (G:)
    adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan
    

  • Chain 'J':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1wuvJ (J:)
    adtivaveldtypntdigdpnyphigidiksvrskktakwnmqngkvgtahiiynsvgkr
    lsavvsypngdsatvsydvdldnvlpewvrvglsastglyketntilswsftsklksnst
    hetnalhfmfnqfskdqkdlilqgdattgtdgnleltrvssngspqgssvgralfyapvh
    iwessavvasfdatftflikspdshpadgiaffisnidssipsgstgrllglfpdan