PDB entry 1wuu

View 1wuu on RCSB PDB site
Description: crystal structure of human galactokinase complexed with MgAMPPNP and galactose
Class: transferase
Keywords: galactosemia, GHMP superfamily, kinase, TRANSFERASE
Deposited on 2004-12-08, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.205
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (8-398)
      • expression tag (6-7)
      • modified residue (61)
      • modified residue (66)
      • modified residue (186)
      • modified residue (191)
      • modified residue (198)
      • modified residue (313)
      • modified residue (349)
      • modified residue (371)
    Domains in SCOPe 2.07: d1wuua1, d1wuua2, d1wuua3
  • Chain 'B':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (8-398)
      • modified residue (61)
      • modified residue (66)
      • modified residue (186)
      • modified residue (191)
      • modified residue (198)
      • modified residue (313)
      • modified residue (349)
      • modified residue (371)
    Domains in SCOPe 2.07: d1wuub1, d1wuub2
  • Chain 'C':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (8-398)
      • expression tag (7)
      • modified residue (61)
      • modified residue (66)
      • modified residue (186)
      • modified residue (191)
      • modified residue (198)
      • modified residue (313)
      • modified residue (349)
      • modified residue (371)
    Domains in SCOPe 2.07: d1wuuc1, d1wuuc2, d1wuuc3
  • Chain 'D':
    Compound: Galactokinase
    Species: Homo sapiens [TaxId:9606]
    Gene: GALK1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P51570 (8-398)
      • expression tag (7)
      • modified residue (61)
      • modified residue (66)
      • modified residue (186)
      • modified residue (191)
      • modified residue (198)
      • modified residue (313)
      • modified residue (349)
      • modified residue (371)
    Domains in SCOPe 2.07: d1wuud1, d1wuud2, d1wuud3
  • Heterogens: GLA, MG, ANP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wuuA (A:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuuA (A:)
    hhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalel
    mtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypa
    aplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfag
    mpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhasseypvrrr
    qceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyr
    afgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaa
    phamrhiqehyggtatfylsqaadgakvlcl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wuuB (B:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuuB (B:)
    aalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelmt
    vlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaap
    lpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagmp
    cgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhlasseypvrrrq
    ceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyra
    fgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaap
    hamrhiqehyggtatfylsqaadgakvlcl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wuuC (C:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuuC (C:)
    haalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelm
    tvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaa
    plpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagm
    pcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhasseypvrrrq
    ceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyra
    fgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaap
    hamrhiqehyggtatfylsqaadgakvlcl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wuuD (D:)
    mahhhhhhaalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvl
    pmalelmtvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgv
    iqyypaaplpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqa
    ehsfagmpcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhslas
    seypvrrrqceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaa
    alrrgdyrafgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctv
    tlleasaaphamrhiqehyggtatfylsqaadgakvlcl
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuuD (D:)
    haalrqpqvaellaearrafreefgaepelavsapgrvnligehtdynqglvlpmalelm
    tvlvgsprkdglvsllttsegadepqrlqfplptaqrslepgtprwanyvkgviqyypaa
    plpgfsavvvssvplggglsssaslevatytflqqlcpdsgtiaaraqvcqqaehsfagm
    pcgimdqfislmgqkghallidcrsletslvplsdpklavlitnsnvrhssseypvrrrq
    ceevaralgkeslrevqleeleaardlvskegfrrarhvvgeirrtaqaaaalrrgdyra
    fgrlmveshrslrddyevscpeldqlveaalavpgvygsrmtgggfggctvtlleasaap
    hamrhiqehyggtatfylsqaadgakvlcl