PDB entry 1wus

View 1wus on RCSB PDB site
Description: Crystal structure of the conserved domain of MS0278
Class: structural genomics, unknown function
Keywords: RUN domain, structural genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, NPPSFA, National Project on Protein Structural and Functional Analyses
Deposited on 2004-12-08, released 2005-06-08
The last revision prior to the SCOPe 2.08 freeze date was dated 2006-08-29, with a file datestamp of 2007-06-01.
Experiment type: XRAY
Resolution: 2.18 Å
R-factor: 0.199
AEROSPACI score: 0.42 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: rap2 interacting protein x
    Species: MUS MUSCULUS
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9D394 (7-End)
      • modified residue (7)
      • modified residue (12)
      • modified residue (15)
      • modified residue (17)
      • modified residue (50)
      • modified residue (114)
      • modified residue (122)
      • modified residue (142-143)
      • modified residue (166)
    Domains in SCOPe 2.08: d1wusa_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wusA (A:)
    gssgssgmanermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglk
    akktflgqnksfwgplelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkkls
    eymkalinkkellsefyevnalmmeeegaiiagllvglnvidanfcmkgedldsqvgvid
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wusA (A:)
    manermnlmnmaklsikgliesalnlgrtldsdyaplqqffvvmehclkhglkanksfwg
    plelveklvpeaaeitasvkdlpglktpvgrgrawlrlalmqkklseymkalinkkells
    efyevnalmmeeegaiiagllvglnvidanfcmkgedldsqv