PDB entry 1wur

View 1wur on RCSB PDB site
Description: Structure of GTP cyclohydrolase I Complexed with 8-oxo-dGTP
Class: hydrolase
Keywords: BETA BARREL, PROTEIN-INHIBITOR COMPLEX, HYDROLASE, PTERIDINE, TETRAHYDROBIOPTERIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-12-08, released 2005-07-19
The last revision prior to the SCOP 1.73 freeze date was dated 2006-01-24, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 1.82 Å
R-factor: 0.206
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wura1
  • Chain 'B':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wurb1
  • Chain 'C':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wurc1
  • Chain 'D':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wurd1
  • Chain 'E':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus
    Database cross-references and differences (RAF-indexed): Domains in SCOP 1.73: d1wure1
  • Heterogens: ZN, 8DG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wurA (A:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wurA (A:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wurB (B:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wurB (B:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wurC (C:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wurC (C:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wurD (D:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wurD (D:)
    evdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpa
    egsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqer
    lavqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreef
    lshlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wurE (E:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wurE (E:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr