PDB entry 1wuq

View 1wuq on RCSB PDB site
Description: Structure of GTP cyclohydrolase I Complexed with 8-oxo-GTP
Class: hydrolase
Keywords: BETA BARREL, PROTEIN-INHIBITOR COMPLEX, HYDROLASE, PTERIDINE, TETRAHYDROBIOPTERIN, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI
Deposited on 2004-12-08, released 2005-07-19
The last revision prior to the SCOPe 2.08 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.207
AEROSPACI score: 0.44 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wuqa_
  • Chain 'B':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wuqb_
  • Chain 'C':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wuqc_
  • Chain 'D':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wuqd_
  • Chain 'E':
    Compound: GTP cyclohydrolase I
    Species: Thermus thermophilus [TaxId:274]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.08: d1wuqe_
  • Heterogens: ZN, 8GT, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wuqA (A:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuqA (A:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wuqB (B:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuqB (B:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wuqC (C:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuqC (C:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wuqD (D:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuqD (D:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >1wuqE (E:)
    mspgpqsggqergsmerkmveledtgltfatevdlerlqalaaewlqvigedpgregllk
    tpervakawafltrgyrqrleevvggavfpaegsemvvvkgvefysmcehhllpffgkvh
    igyipdgkilglskfarivdmfarrlqvqerlavqiaeaiqevlepqgvgvvvegvhlcm
    mmrgvekqhsrtvtsamlgvfrenqktreeflshlrdgta
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuqE (E:)
    vdlerlqalaaewlqvigedpgregllktpervakawafltrgyrqrleevvggavfpae
    gsemvvvkgvefysmcehhllpffgkvhigyipdgkilglskfarivdmfarrlqvqerl
    avqiaeaiqevlepqgvgvvvegvhlcmmmrgvekqhsrtvtsamlgvfrenqktreefl
    shlr