PDB entry 1wuo

View 1wuo on RCSB PDB site
Description: Crystal structure of metallo-beta-lactamase IMP-1 mutant (D81A)
Class: hydrolase
Keywords: metallo-beta-lactamase, hydrolysis, aspartic acid, HYDROLASE
Deposited on 2004-12-08, released 2005-03-29
The last revision prior to the SCOPe 2.07 freeze date was dated 2014-11-12, with a file datestamp of 2014-11-07.
Experiment type: XRAY
Resolution: 2.01 Å
R-factor: 0.212
AEROSPACI score: 0.34 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: beta-lactamase imp-1
    Species: Serratia marcescens [TaxId:615]
    Gene: BLAIMP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52699
      • engineered mutation (80)
    Domains in SCOPe 2.07: d1wuoa_
  • Chain 'B':
    Compound: beta-lactamase imp-1
    Species: Serratia marcescens [TaxId:615]
    Gene: BLAIMP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52699
      • engineered mutation (80)
    Domains in SCOPe 2.07: d1wuob_
  • Chain 'C':
    Compound: beta-lactamase imp-1
    Species: Serratia marcescens [TaxId:615]
    Gene: BLAIMP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52699
      • engineered mutation (80)
    Domains in SCOPe 2.07: d1wuoc_
  • Chain 'D':
    Compound: beta-lactamase imp-1
    Species: Serratia marcescens [TaxId:615]
    Gene: BLAIMP-1
    Database cross-references and differences (RAF-indexed):
    • Uniprot P52699
      • engineered mutation (80)
    Domains in SCOPe 2.07: d1wuod_
  • Heterogens: ZN, ACY, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wuoA (A:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuoA (A:)
    slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
    fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
    ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
    lkskygkaklvvpshsevgdasllkltleqavkglnesk
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wuoB (B:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuoB (B:)
    slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
    fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
    ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
    lkskygkaklvvpshsevgdasllkltleqavkglnesk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1wuoC (C:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuoC (C:)
    slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
    fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
    ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
    lkskygkaklvvpshsevgdasllkltleqavkglnesk
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wuoD (D:)
    aeslpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklv
    twfvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsg
    vnywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksa
    kllkskygkaklvvpshsevgdasllkltleqavkglneskkpskpsn
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wuoD (D:)
    slpdlkiekldegvyvhtsfeevngwgvvpkhglvvlvnaeaylidtpftakdteklvtw
    fvergykikgsisshfhsastggiewlnsrsiptyaseltnellkkdgkvqatnsfsgvn
    ywlvknkievfypgpghtpdnvvvwlperkilfggcfikpyglgnlgdanieawpksakl
    lkskygkaklvvpshsevgdasllkltleqavkglnesk