PDB entry 1wuf

View 1wuf on RCSB PDB site
Description: Crystal structure of protein GI:16801725, member of Enolase superfamily from Listeria innocua Clip11262
Class: structural genomics, unknown function
Keywords: Structural genomics, Unknown function, NYSGXRC TARGET T2186, enolase superfamily, PROTEIN STRUCTURE INITIATIVE, PSI, New York Structural GenomiX Research Consortium
Deposited on 2004-12-07, released 2004-12-21
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.236
AEROSPACI score: 0.27 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hypothetical protein lin2664
    Species: Listeria innocua Clip11262
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q927X3
      • cloning artifact (18)
    Domains in SCOP 1.75: d1wufa1, d1wufa2
  • Chain 'B':
    Compound: hypothetical protein lin2664
    Species: Listeria innocua Clip11262
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q927X3 (19-End)
      • cloning artifact (18)
    Domains in SCOP 1.75: d1wufb1, d1wufb2
  • Heterogens: MG

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wufA (A:)
    ghhhhhhhhhhglvprgshmyfqkarlihaelpllapfktsygelkskdfyiielineeg
    ihgygeleafplpdyteetlssailiikeqllpllaqrkirkpeeiqelfswiqgnemak
    aavelavwdafakmekrslakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyerv
    klkiapnkdiqfveavrksfpklslmadansaynredflllkeldqydlemieqpfgtkd
    fvdhawlqkqlktricldenirsvkdveqahsigscrainlklarvggmssalkiaeyca
    lneilvwcggmleagvgrahnialaarnefvfpgdisasnrffaedivtpafelnqgrlk
    vptnegigvtldlkvlkkytksteeillnkgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wufA (A:)
    hmyfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdytee
    tlssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrs
    lakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrk
    sfpklslmadansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricld
    enirsvkdveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgr
    ahnialaarnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkk
    ytksteeilln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wufB (B:)
    ghhhhhhhhhhglvprgshmyfqkarlihaelpllapfktsygelkskdfyiielineeg
    ihgygeleafplpdyteetlssailiikeqllpllaqrkirkpeeiqelfswiqgnemak
    aavelavwdafakmekrslakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyerv
    klkiapnkdiqfveavrksfpklslmadansaynredflllkeldqydlemieqpfgtkd
    fvdhawlqkqlktricldenirsvkdveqahsigscrainlklarvggmssalkiaeyca
    lneilvwcggmleagvgrahnialaarnefvfpgdisasnrffaedivtpafelnqgrlk
    vptnegigvtldlkvlkkytksteeillnkgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wufB (B:)
    hmyfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdytee
    tlssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrs
    lakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrk
    sfpklslmadansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricld
    enirsvkdveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgr
    ahnialaarnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkk
    ytksteeilln