PDB entry 1wuf

View 1wuf on RCSB PDB site
Description: crystal structure of protein gi:16801725, member of enolase superfamily from listeria innocua clip11262
Deposited on 2004-12-07, released 2004-12-21
The last revision prior to the SCOP 1.71 freeze date was dated 2004-12-21, with a file datestamp of 2004-12-21.
Experiment type: XRAY
Resolution: 2.9 Å
R-factor: 0.236
AEROSPACI score: 0.22 (click here for full SPACI score report)

Chains and heterogens:

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wufA (A:)
    ghhhhhhhhhhglvprgshmyfqkarlihaelpllapfktsygelkskdfyiielineeg
    ihgygeleafplpdyteetlssailiikeqllpllaqrkirkpeeiqelfswiqgnemak
    aavelavwdafakmekrslakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyerv
    klkiapnkdiqfveavrksfpklslmadansaynredflllkeldqydlemieqpfgtkd
    fvdhawlqkqlktricldenirsvkdveqahsigscrainlklarvggmssalkiaeyca
    lneilvwcggmleagvgrahnialaarnefvfpgdisasnrffaedivtpafelnqgrlk
    vptnegigvtldlkvlkkytksteeillnkgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wufA (A:)
    hmyfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdytee
    tlssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrs
    lakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrk
    sfpklslmadansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricld
    enirsvkdveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgr
    ahnialaarnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkk
    ytksteeilln
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wufB (B:)
    ghhhhhhhhhhglvprgshmyfqkarlihaelpllapfktsygelkskdfyiielineeg
    ihgygeleafplpdyteetlssailiikeqllpllaqrkirkpeeiqelfswiqgnemak
    aavelavwdafakmekrslakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyerv
    klkiapnkdiqfveavrksfpklslmadansaynredflllkeldqydlemieqpfgtkd
    fvdhawlqkqlktricldenirsvkdveqahsigscrainlklarvggmssalkiaeyca
    lneilvwcggmleagvgrahnialaarnefvfpgdisasnrffaedivtpafelnqgrlk
    vptnegigvtldlkvlkkytksteeillnkgws
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wufB (B:)
    hmyfqkarlihaelpllapfktsygelkskdfyiielineegihgygeleafplpdytee
    tlssailiikeqllpllaqrkirkpeeiqelfswiqgnemakaavelavwdafakmekrs
    lakmigatkesikvgvsiglqqnvetllqlvnqyvdqgyervklkiapnkdiqfveavrk
    sfpklslmadansaynredflllkeldqydlemieqpfgtkdfvdhawlqkqlktricld
    enirsvkdveqahsigscrainlklarvggmssalkiaeycalneilvwcggmleagvgr
    ahnialaarnefvfpgdisasnrffaedivtpafelnqgrlkvptnegigvtldlkvlkk
    ytksteeilln