PDB entry 1wue

View 1wue on RCSB PDB site
Description: Crystal structure of protein GI:29375081, unknown member of enolase superfamily from enterococcus faecalis V583
Class: structural genomics, unknown function
Keywords: Structural genomics, unknown function, NYSGXRC TARGET T2185, PROTEIN STRUCTURE INITIATIVE, ENOLASE SUPERFAMILY, PSI, New York Structural GenomiX Research Consortium
Deposited on 2004-12-05, released 2004-12-21
The last revision prior to the SCOP 1.75 freeze date was dated 2005-01-25, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: 0.207
AEROSPACI score: 0.49 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Enterococcus faecalis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838J7
      • cloning artifact (16-18)
    Domains in SCOP 1.75: d1wuea1, d1wuea2
  • Chain 'B':
    Compound: mandelate racemase/muconate lactonizing enzyme family protein
    Species: Enterococcus faecalis
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q838J7 (19-385)
      • cloning artifact (17-18)
    Domains in SCOP 1.75: d1wueb1, d1wueb2
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wueA (A:)
    ghhhhhhhhhhglvprgshmniqsietyqvrlplktpfvtsygrleekafdlfvitdeqg
    nqgfgelvafeqpdyvqetlvterfiiqqhliplllteaieqpqevstifeevkghwmgk
    aaletaiwdlyakrqqkslteffgptrrkipvgislgiqedlpqllkqvqlavekgyqrv
    klkirpgydvepvalirqhfpnlplmvdansaytladlpqlqrldhyqlamieqpfaadd
    fldhaqlqrelktricldenirslkdcqvalalgscrsinlkiprvggihealkiaafcq
    endllvwlggmfesgvgralnlqfasqptfsfpgdisateryfyediitepfileqgtmt
    vpqglgigvtlsqtnllkysqyqkim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wueA (A:)
    gshmniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyv
    qetlvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqq
    kslteffgptrrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvali
    rqhfpnlplmvdansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktric
    ldenirslkdcqvalalgscrsinlkiprvggihealkiaafcqendllvwlggmfesgv
    gralnlqfasqptfsfpgdisateryfyediitepfileqgtmtvpqglgigvtlsqtnl
    lkysqyqkim
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wueB (B:)
    ghhhhhhhhhhglvprgshmniqsietyqvrlplktpfvtsygrleekafdlfvitdeqg
    nqgfgelvafeqpdyvqetlvterfiiqqhliplllteaieqpqevstifeevkghwmgk
    aaletaiwdlyakrqqkslteffgptrrkipvgislgiqedlpqllkqvqlavekgyqrv
    klkirpgydvepvalirqhfpnlplmvdansaytladlpqlqrldhyqlamieqpfaadd
    fldhaqlqrelktricldenirslkdcqvalalgscrsinlkiprvggihealkiaafcq
    endllvwlggmfesgvgralnlqfasqptfsfpgdisateryfyediitepfileqgtmt
    vpqglgigvtlsqtnllkysqyqkim
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wueB (B:)
    shmniqsietyqvrlplktpfvtsygrleekafdlfvitdeqgnqgfgelvafeqpdyvq
    etlvterfiiqqhliplllteaieqpqevstifeevkghwmgkaaletaiwdlyakrqqk
    slteffgptrrkipvgislgiqedlpqllkqvqlavekgyqrvklkirpgydvepvalir
    qhfpnlplmvdansaytladlpqlqrldhyqlamieqpfaaddfldhaqlqrelktricl
    denirslkdcqvalalgscrsinlkiprvggihealkiaafcqendllvwlggmfesgvg
    ralnlqfasqptfsfpgdisateryfyediitepfileqgtmtvpqglgigvtlsqtnll
    kysqyqkim