PDB entry 1wud

View 1wud on RCSB PDB site
Description: E. coli RecQ HRDC domain
Class: hydrolase
Keywords: RecQ, DNA-binding domain, HRDC, helicase, HYDROLASE
Deposited on 2004-12-04, released 2005-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-08.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.227
AEROSPACI score: 0.35 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: ATP-dependent DNA helicase recQ
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15043
      • modified residue (45)
      • modified residue (49)
      • modified residue (56)
      • modified residue (64)
      • modified residue (75)
    Domains in SCOPe 2.07: d1wuda1
  • Chain 'B':
    Compound: ATP-dependent DNA helicase recQ
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15043
      • modified residue (45)
      • modified residue (49)
      • modified residue (56)
      • modified residue (64)
      • modified residue (75)
    Domains in SCOPe 2.07: d1wudb_
  • Chain 'D':
    Compound: ATP-dependent DNA helicase recQ
    Species: Escherichia coli [TaxId:562]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P15043
      • modified residue (45)
      • modified residue (49)
      • modified residue (56)
      • modified residue (64)
      • modified residue (75)
    Domains in SCOPe 2.07: d1wudd_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wudA (A:)
    gshqksfggnydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsv
    ngvgmrklerfgkpfmalirahvdgddee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wudA (A:)
    nydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkle
    rfgkpfmalirahvdgd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1wudB (B:)
    gshqksfggnydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsv
    ngvgmrklerfgkpfmalirahvdgddee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wudB (B:)
    ydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkler
    fgkpfmalirahvdgd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1wudD (D:)
    gshqksfggnydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsv
    ngvgmrklerfgkpfmalirahvdgddee
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wudD (D:)
    ydrklfaklrklrksiadesnvppyvvfndatliemaeqmpitasemlsvngvgmrkler
    fgkpfmalirahvdgd