PDB entry 1wuc

View 1wuc on RCSB PDB site
Description: Crystal structure of the type 1 RIP bouganin
Class: plant protein
Keywords: alpha-beta protein, PLANT PROTEIN
Deposited on 2004-12-04, released 2005-12-13
The last revision prior to the SCOPe 2.07 freeze date was dated 2008-05-27, with a file datestamp of 2008-05-23.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: 0.176
AEROSPACI score: 0.52 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: bouganin
    Species: Bougainvillea spectabilis
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1wuca_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1wucA (A:)
    lgyntvsfnlgeayeyptfiqdlrnelakgtpvcqlpvtlqtiaddkrfvlvditttskk
    tvkvaidvtdvyvvgyqdkwdgkdravfldkvptvatsklfpgvtnrvtltfdgsyqklv
    naakvdrkdlelgvyklefsieaihgktingqeiakffliviqmvseaarfkyietevvd
    rglygsfkpnfkvlnlennwgdisdaihksspqcttinpalqlispsndpwvvnkvsqis
    pdmgilkfks
    

    Sequence, based on observed residues (ATOM records): (download)
    >1wucA (A:)
    yntvsfnlgeayeyptfiqdlrnelakgtpvcqlpvtlqtiaddkrfvlvditttskktv
    kvaidvtdvyvvgyqdkwdgkdravfldkvptvatsklfpgvtnrvtltfdgsyqklvna
    akvdrkdlelgvyklefsieaihgktingqeiakffliviqmvseaarfkyietevvdrg
    lygsfkpnfkvlnlennwgdisdaihksspqcttinpalqlispsndpwvvnkvsqispd
    mgilkfks